PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G224500.1.p
Common NameSb09g027800, SORBIDRAFT_09g027800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 290aa    MW: 30436.3 Da    PI: 7.7052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G224500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          rg+W++eEde+l  +v++ G g +W + +++ g++R++k+c++rw++yl
  Sobic.009G224500.1.p 14 RGPWSPEEDEQLRSYVQRNGIGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                          89******************999************************97 PP

2Myb_DNA-binding36.79.9e-1271111446
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            T+eEd ++  +    G++ W+ Ia++++ gRt++++k++w++
  Sobic.009G224500.1.p  71 YTEEEDRIIWSLYSSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                           69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.294966IPR017930Myb domain
SuperFamilySSF466897.52E-2811109IPR009057Homeodomain-like
SMARTSM007177.7E-111364IPR001005SANT/Myb domain
PfamPF002498.7E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-231569IPR009057Homeodomain-like
CDDcd001671.52E-81662No hitNo description
SMARTSM007177.3E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129415.22567117IPR017930Myb domain
PfamPF002491.9E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2270116IPR009057Homeodomain-like
CDDcd001671.54E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDEQLRSYVQ RNGIGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEEEDRIIW SLYSSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMAM  120
AAAAGLSASS SGGGAFAAAA APATPTPPAL SPASSSVTSS SGDVRFGAAY TEPQPQPQHP  180
GGLIRFDAPR TELAPVPPAV GAQLDGAWST PVAPALDGGD VFLPELIGGG EQLFPYGGDF  240
FGGLLQDSRA LEQLSACYFP NMAEIWGATA AVAAPDGNCK PPGLCNTLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794301e-179HF679430.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB24 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440207.10.0hypothetical protein SORBIDRAFT_09g027800
SwissprotQ9FKL22e-70MYB36_ARATH; Transcription factor MYB36
TrEMBLC5YV340.0C5YV34_SORBI; Putative uncharacterized protein Sb09g027800
STRINGSb09g027800.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-69myb domain protein 36